![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) ![]() |
![]() | Family c.52.1.20: XPF/Rad1/Mus81 nuclease [89716] (3 proteins) |
![]() | Protein XPF endonuclease [142447] (1 species) |
![]() | Species Aeropyrum pernix [TaxId:56636] [142448] (2 PDB entries) Uniprot Q9YC15 16-148 |
![]() | Domain d2bhnc2: 2bhn C:20-147 [128539] Other proteins in same PDB: d2bhna1, d2bhnb1, d2bhnc1, d2bhnd1 automatically matched to 2BGW A:16-148 |
PDB Entry: 2bhn (more details), 3.2 Å
SCOPe Domain Sequences for d2bhnc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bhnc2 c.52.1.20 (C:20-147) XPF endonuclease {Aeropyrum pernix [TaxId: 56636]} rvyvdvreerspvpsileslgvqvipkqlpmgdylvsdsiiverktssdfakslfdgrlf eqasrlaehyetvfiivegppvprryrgrerslyaamaalqldygirlmntmdpkgtalv ieslarls
Timeline for d2bhnc2: