Lineage for d2bhnb2 (2bhn B:19-148)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1371642Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1371643Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) (S)
  5. 1371940Family c.52.1.20: XPF/Rad1/Mus81 nuclease [89716] (3 proteins)
  6. 1371952Protein XPF endonuclease [142447] (1 species)
  7. 1371953Species Aeropyrum pernix [TaxId:56636] [142448] (2 PDB entries)
    Uniprot Q9YC15 16-148
  8. 1371957Domain d2bhnb2: 2bhn B:19-148 [128537]
    Other proteins in same PDB: d2bhna1, d2bhnb1, d2bhnc1, d2bhnd1
    automatically matched to 2BGW A:16-148

Details for d2bhnb2

PDB Entry: 2bhn (more details), 3.2 Å

PDB Description: xpf from aeropyrum pernix
PDB Compounds: (B:) xpf endonuclease

SCOPe Domain Sequences for d2bhnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bhnb2 c.52.1.20 (B:19-148) XPF endonuclease {Aeropyrum pernix [TaxId: 56636]}
prvyvdvreerspvpsileslgvqvipkqlpmgdylvsdsiiverktssdfakslfdgrl
feqasrlaehyetvfiivegppvprryrgrerslyaamaalqldygirlmntmdpkgtal
vieslarlst

SCOPe Domain Coordinates for d2bhnb2:

Click to download the PDB-style file with coordinates for d2bhnb2.
(The format of our PDB-style files is described here.)

Timeline for d2bhnb2: