SCOPe 2.08: Domain d2bfgb1: 2bfg B:2-13,B:361-502

Lineage for d2bfgb1 (2bfg B:2-13,B:361-502)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins)
   interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain

6. Protein Beta-D-xylosidase [101926] (2 species)
   glycosyl hydrolase family 39

7. Species Bacillus stearothermophilus [TaxId:1422] [141555] (3 PDB entries)
   Uniprot Q9ZFM2 5-14,362-503

8. Domain d2bfgb1: 2bfg B:2-13,B:361-502 [128425]
   Other proteins in same PDB: d2bfga2, d2bfgb2, d2bfgc2, d2bfgd2, d2bfge2, d2bfgf2, d2bfgg2, d2bfgh2
   automated match to d2bfga1
   complexed with anx, na, so4, xyp, xys

Details for d2bfgb1

PDB Entry: 2bfg, 2.4 Å

PDB Description: crystal structure of beta-xylosidase (fam gh39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside

PDB Compounds: (B:) beta-xylosidase

SCOPe Domain Sequences for d2bfgb1:

Sequence; same for both SEQRES and ATOM records:

>d2bfgb1 b.71.1.2 (B:2-13,B:361-502) Beta-D-xylosidase {Bacillus stearothermophilus [TaxId: 1422]}
gvvnvpsngrekXellyrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvses
avfikrqivneqygnawrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihls
ivlsknevtlieieqvrdetstyvglddgeitsys

Timeline for d2bfgb1:

• d2bfgb1 first appeared in SCOP 1.73
  
• d2bfgb1 appears in SCOPe 2.07