SCOPe 2.02: Domain d2bewb2: 2bew B:205-342

Lineage for d2bewb2 (2bew B:205-342)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest

4. Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families)

5. Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (4 proteins)

6. Protein Branched-chain alpha-keto acid dehydrogenase [52927] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52928] (21 PDB entries)
   Uniprot P21953 52-392

8. Domain d2bewb2: 2bew B:205-342 [128397]
   Other proteins in same PDB: d2bewa_, d2bewb1
   automatically matched to d1dtwb2
   complexed with cl, gol, k, mn, thw

Details for d2bewb2

PDB Entry: 2bew, 1.79 Å

PDB Description: reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch

PDB Compounds: (B:) 2-oxoisovalerate dehydrogenase beta subunit

SCOPe Domain Sequences for d2bewb2:

Sequence; same for both SEQRES and ATOM records:

>d2bewb2 c.48.1.2 (B:205-342) Branched-chain alpha-keto acid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
pyniplsqaeviqegsdvtlvawgtqvhvirevasmakeklgvscevidlrtiipwdvdt
icksviktgrllisheapltggfaseisstvqeecflnleapisrvcgydtpfphifepf
yipdkwkcydalrkminy

Timeline for d2bewb2:

• d2bewb2 first appeared in SCOP 1.73
  
• d2bewb2 appears in SCOPe 2.01
  
• d2bewb2 appears in SCOPe 2.03
  
• d2bewb2 appears in the current release, SCOPe 2.08