Lineage for d2be5f3 (2be5 F:74-257)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 650700Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily)
    multihelical; consists of a conserved 4-helical core and a variable insert subdomain
  4. 650701Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (1 family) (S)
  5. 650702Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (5 proteins)
  6. 650718Protein Sigma70 [88948] (2 species)
  7. 650721Species Thermus thermophilus [TaxId:274] [88949] (9 PDB entries)
  8. 650730Domain d2be5f3: 2be5 F:74-257 [128360]
    Other proteins in same PDB: d2be5a1, d2be5a2, d2be5b1, d2be5b2, d2be5c1, d2be5d1, d2be5e1, d2be5f1, d2be5f2, d2be5k1, d2be5k2, d2be5l1, d2be5l2, d2be5m1, d2be5n1, d2be5o1, d2be5p1, d2be5p2
    automatically matched to d1iw7f3
    complexed with mg, tgt, zn

Details for d2be5f3

PDB Entry: 2be5 (more details), 2.4 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme in complex with inhibitor tagetitoxin
PDB Compounds: (F:) RNA polymerase sigma factor rpoD

SCOP Domain Sequences for d2be5f3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2be5f3 a.177.1.1 (F:74-257) Sigma70 {Thermus thermophilus [TaxId: 274]}
kistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvra
kilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlr
lvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiad
qart

SCOP Domain Coordinates for d2be5f3:

Click to download the PDB-style file with coordinates for d2be5f3.
(The format of our PDB-style files is described here.)

Timeline for d2be5f3: