Lineage for d2be5b2 (2be5 B:50-172)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 739032Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 739033Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
  5. 739034Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)
  6. 739035Protein RNA polymerase alpha subunit [56555] (3 species)
  7. 739050Species Thermus thermophilus [TaxId:274] [75595] (9 PDB entries)
  8. 739068Domain d2be5b2: 2be5 B:50-172 [128354]
    Other proteins in same PDB: d2be5a1, d2be5b1, d2be5c1, d2be5d1, d2be5e1, d2be5f1, d2be5f2, d2be5f3, d2be5k1, d2be5l1, d2be5m1, d2be5n1, d2be5o1, d2be5p1, d2be5p2, d2be5p3
    automatically matched to d1iw7a2
    complexed with mg, tgt, zn

Details for d2be5b2

PDB Entry: 2be5 (more details), 2.4 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme in complex with inhibitor tagetitoxin
PDB Compounds: (B:) DNA-directed RNA polymerase alpha chain

SCOP Domain Sequences for d2be5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2be5b2 d.181.1.1 (B:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

SCOP Domain Coordinates for d2be5b2:

Click to download the PDB-style file with coordinates for d2be5b2.
(The format of our PDB-style files is described here.)

Timeline for d2be5b2: