SCOP 1.75: Domain d2bayf1: 2bay F:1-56

Lineage for d2bayf1 (2bay F:1-56)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (6 families)

5. Family g.44.1.2: U-box [90222] (4 proteins)
   Associated with multi-ubiquitination; lacks the RING-domain metal ion-binding residues

6. Protein Pre-mRNA splicing factor Prp19 [90223] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90224] (2 PDB entries)

8. Domain d2bayf1: 2bay F:1-56 [128256]
   automatically matched to d1n87a_

Details for d2bayf1

PDB Entry: 2bay, 1.5 Å

PDB Description: Crystal structure of the Prp19 U-box dimer

PDB Compounds: (F:) Pre-mRNA splicing factor PRP19

SCOP Domain Sequences for d2bayf1:

Sequence; same for both SEQRES and ATOM records:

>d2bayf1 g.44.1.2 (F:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mlcaisgkvprrpvlspksrtifekslleqyvkdtgndpitneplsieeiveivps

Timeline for d2bayf1:

• d2bayf1 first appeared in SCOP 1.73
  
• d2bayf1 is called d2bayf_ in SCOPe 2.01
  
• d2bayf1 appears in the current release, SCOPe 2.08, called d2bayf2