![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
![]() | Superfamily g.44.1: RING/U-box [57850] (6 families) ![]() |
![]() | Family g.44.1.2: U-box [90222] (4 proteins) Associated with multi-ubiquitination; lacks the RING-domain metal ion-binding residues |
![]() | Protein Pre-mRNA splicing factor Prp19 [90223] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90224] (2 PDB entries) |
![]() | Domain d1n87a_: 1n87 A: [85390] |
PDB Entry: 1n87 (more details)
SCOP Domain Sequences for d1n87a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n87a_ g.44.1.2 (A:) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mlcaisgkvprrpvlspksrtifekslleqyvkdtgndpitneplsieeiveivps
Timeline for d1n87a_: