Lineage for d1n87a_ (1n87 A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 893809Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 893810Superfamily g.44.1: RING/U-box [57850] (6 families) (S)
  5. 893861Family g.44.1.2: U-box [90222] (4 proteins)
    Associated with multi-ubiquitination; lacks the RING-domain metal ion-binding residues
  6. 893865Protein Pre-mRNA splicing factor Prp19 [90223] (1 species)
  7. 893866Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90224] (2 PDB entries)
  8. 893873Domain d1n87a_: 1n87 A: [85390]

Details for d1n87a_

PDB Entry: 1n87 (more details)

PDB Description: solution structure of the u-box of prp19
PDB Compounds: (A:) Pre-mRNA splicing factor PRP19

SCOP Domain Sequences for d1n87a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n87a_ g.44.1.2 (A:) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mlcaisgkvprrpvlspksrtifekslleqyvkdtgndpitneplsieeiveivps

SCOP Domain Coordinates for d1n87a_:

Click to download the PDB-style file with coordinates for d1n87a_.
(The format of our PDB-style files is described here.)

Timeline for d1n87a_: