SCOPe 2.01: Domain d2baye_: 2bay E:

Lineage for d2baye_ (2bay E:)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.2: U-box [90222] (5 proteins)
   Associated with multi-ubiquitination; lacks the RING-domain metal ion-binding residues

6. Protein automated matches [190212] (1 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186968] (1 PDB entry)

8. Domain d2baye_: 2bay E: [128255]
   automated match to d1n87a_

Details for d2baye_

PDB Entry: 2bay, 1.5 Å

PDB Description: Crystal structure of the Prp19 U-box dimer

PDB Compounds: (E:) Pre-mRNA splicing factor PRP19

SCOPe Domain Sequences for d2baye_:

Sequence; same for both SEQRES and ATOM records:

>d2baye_ g.44.1.2 (E:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gshmlcaisgkvprrpvlspksrtifekslleqyvkdtgndpitneplsieeiveivps

Timeline for d2baye_:

• d2baye_ first appeared in SCOP 1.73, called d2baye1
  
• d2baye_ was called d2baye1 in SCOP 1.75
  
• d2baye_ appears in SCOPe 2.02
  
• d2baye_ appears in the current release, SCOPe 2.08, called d2baye2