Lineage for d2b9ea1 (2b9e A:133-425)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130236Family c.66.1.38: NOL1/NOP2/sun [102575] (3 protein domains)
    Pfam PF01189; contains additional N-terminal 3-helical and ferredoxin-like domains
  6. 2130240Protein NOL1R [142587] (1 species)
  7. 2130241Species Human (Homo sapiens) [TaxId:9606] [142588] (1 PDB entry)
    Uniprot Q96P11 133-425
  8. 2130242Domain d2b9ea1: 2b9e A:133-425 [128124]
    complexed with sam

Details for d2b9ea1

PDB Entry: 2b9e (more details), 1.65 Å

PDB Description: Human NSUN5 protein
PDB Compounds: (A:) NOL1/NOP2/Sun domain family, member 5 isoform 2

SCOPe Domain Sequences for d2b9ea1:

Sequence, based on SEQRES records: (download)

>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]}
qlprfvrvntlktcsddvvdyfkrqgfsyqgrasslddlralkgkhflldplmpellvfp
aqtdlhehplyraghlilqdrasclpamlldpppgshvidacaapgnktshlaallknqg
kifafdldakrlasmatllaragvsccelaeedflavspsdpryhevhyilldpscsgsg
mpsrqleepgagtpspvrlhalagfqqralchaltfpslqrlvystcslcqeenedvvrd
alqqnpgafrlapalpawphrglstfpgaehclraspettlssgffvavierv

Sequence, based on observed residues (ATOM records): (download)

>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]}
qlprfvrvntlktcsddvvdyfkrqgfsyqgrasslddlralkgkhflldplmpellvfp
aqtdlhehplyraghlilqdrasclpamlldpppgshvidacaapgnktshlaallknqg
kifafdldakrlasmatllaragvsccelaeedflavspsdpryhevhyilldpscsgvr
lhalagfqqralchaltfpslqrlvystcslcqeenedvvrdalqqnpgafrlapalpaw
phrglstfpgaehclraspettlssgffvavierv

SCOPe Domain Coordinates for d2b9ea1:

Click to download the PDB-style file with coordinates for d2b9ea1.
(The format of our PDB-style files is described here.)

Timeline for d2b9ea1: