Lineage for d2b8na_ (2b8n A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921738Fold c.118: GckA/TtuD-like [82543] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 6 strands, order 321456, Rossmann-like topology
    Domain 2 has mixed sheet of 6 strands, order 126345; strands 5 and 6 are antiparallel to the rest; some similarity to CbiF Domain 2
  4. 2921739Superfamily c.118.1: GckA/TtuD-like [82544] (2 families) (S)
  5. 2921740Family c.118.1.1: GckA/TtuD-like [82545] (1 protein)
  6. 2921741Protein Putative glycerate kinase (hypothetical protein TM1585) [82546] (1 species)
  7. 2921742Species Thermotoga maritima [TaxId:2336] [82547] (2 PDB entries)
  8. 2921743Domain d2b8na_: 2b8n A: [128093]
    automated match to d1o0ua_

Details for d2b8na_

PDB Entry: 2b8n (more details), 2.53 Å

PDB Description: crystal structure of glycerate kinase (ec 2.7.1.31) (tm1585) from thermotoga maritima at 2.70 a resolution
PDB Compounds: (A:) glycerate kinase, putative

SCOPe Domain Sequences for d2b8na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b8na_ c.118.1.1 (A:) Putative glycerate kinase (hypothetical protein TM1585) {Thermotoga maritima [TaxId: 2336]}
peslkklaieivkksieavfpdravketlpklnldrvilvavgkaawrmakaayevlgkk
irkgvvvtkyghsegpiddfeiyeaghpvpdentikttrrvlelvdqlnendtvlfllsg
ggsslfelplegvsleeiqkltsallksgasieeintvrkhlsqvkggrfaervfpakvv
alvlsdvlgdrldviasgpawpdsstsedalkvlekygietsesvkrailqetpkhlsnv
eihlignvqkvcdeakslakekgfnaeiittsldceareagrfiasimkevkfkdrplkk
paalifggetvvhvkgngiggrnqelalsaaialegiegvilcsagtdgtdgptdaaggi
vdgstaktlkamgedpyqylknndsynalkksgallitgptgtnvndliigliv

SCOPe Domain Coordinates for d2b8na_:

Click to download the PDB-style file with coordinates for d2b8na_.
(The format of our PDB-style files is described here.)

Timeline for d2b8na_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2b8nb_