Lineage for d1o0ua_ (1o0u A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.118: GckA/TtuD-like [82543] (1 superfamily)
consists of two non-similar domains
Domain 1 has parallel sheet of 6 strands, order 321456, Rossmann-like topology
Domain 2 has mixed sheet of 6 strands, order 126345; strands 5 and 6 are antiparallel to the rest; some similarity to CbiF Domain 2Superfamily c.118.1: GckA/TtuD-like [82544] (2 families) 
Family c.118.1.1: GckA/TtuD-like [82545] (1 protein) Protein Putative glycerate kinase (hypothetical protein TM1585) [82546] (1 species) Species Thermotoga maritima [TaxId:2336] [82547] (2 PDB entries) 
Domain d1o0ua_: 1o0u A: [302797]
automated match to d2b8na_
Details for d1o0ua_
PDB Entry: 1o0u (more details), 2.95 Å
PDB Description: Crystal structure of Glycerate kinase (TM1585) from Thermotoga maritima at 2.95 A resolution
PDB Compounds: (A:) Glycerate kinaseSCOPe Domain Sequences for d1o0ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o0ua_ c.118.1.1 (A:) Putative glycerate kinase (hypothetical protein TM1585) {Thermotoga maritima [TaxId: 2336]}
peslkklaieivkksieavfpdravketlpklnldrvilvavgkaawrmakaayevlgkk
irkgvvvtkyghsegpiddfeiyeaghpvpdentikttrrvlelvdqlnendtvlfllsg
ggsslfelplegvsleeiqkltsallksgasieeintvrkhlsqvkggrfaervfpakvv
alvlsdvlgdrldviasgpawpdsstsedalkvlekygietsesvkrailqetpkhlsnv
eihlignvqkvcdeakslakekgfnaeiittsldceareagrfiasimkevkfkdrplkk
paalifggetvvhvkgngiggrnqelalsaaialegiegvilcsagtdgtdgptdaaggi
vdgstaktlkamgedpyqylknndsynalkksgallitgptgtnvndliigliv
SCOPe Domain Coordinates for d1o0ua_:
Click to download the PDB-style file with coordinates for d1o0ua_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1o0ua_:
- d1o0ua_ first appeared in SCOPe 2.06
- d1o0ua_ appears in SCOPe 2.07
View in 3D
