SCOPe 2.08: Domain d2b7kc_: 2b7k C:

Lineage for d2b7kc_ (2b7k C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein Thioredoxin-like protein Sco1 (YpmQ), soluble domain [102459] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [142372] (2 PDB entries)
   Uniprot P23833 111-262

8. Domain d2b7kc_: 2b7k C: [128044]
   automated match to d2b7ja1
   complexed with pt

Details for d2b7kc_

PDB Entry: 2b7k, 1.8 Å

PDB Description: Crystal Structure of Yeast Sco1

PDB Compounds: (C:) SCO1 protein

SCOPe Domain Sequences for d2b7kc_:

Sequence, based on SEQRES records:

>d2b7kc_ c.47.1.10 (C:) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gkpslggpfhledmygnefteknllgkfsiiyfgfsncpdicpdeldklglwlntlssky
gitlqplfitcdpardspavlkeylsdfhpsilgltgtfdevknackkyrvyfstppnvk
pgqdylvdhsiffylmdpegqfvdalgrnydektgvdkivehvksyvpa

Sequence, based on observed residues (ATOM records):

>d2b7kc_ c.47.1.10 (C:) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gkpslggpfhledmygnefteknllgkfsiiyfgfsncpdicpdeldklglwlntlssky
gitlqplfitcdpardspavlkeylsdfhpsilgltgtfdevknackkyrvlvdhsiffy
lmdpegqfvdalgrnydektgvdkivehvksyvpa

Timeline for d2b7kc_:

• d2b7kc_ first appeared in SCOP 1.73, called d2b7kc1
  
• d2b7kc_ appears in SCOPe 2.07