Lineage for d2b7dt1 (2b7d T:6-106)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1767525Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1767526Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1767626Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 1767627Species Human (Homo sapiens) [TaxId:9606] [49268] (34 PDB entries)
    Uniprot P13726 33-242
  8. 1767667Domain d2b7dt1: 2b7d T:6-106 [128034]
    Other proteins in same PDB: d2b7dh_, d2b7dl1, d2b7dl2
    automated match to d1o5dt1
    complexed with c1b

Details for d2b7dt1

PDB Entry: 2b7d (more details), 2.24 Å

PDB Description: factor viia inhibitors: chemical optimization, preclinical pharmacokinetics, pharmacodynamics, and efficacy in a baboon thrombosis model
PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d2b7dt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b7dt1 b.1.2.1 (T:6-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagnvestgsageplyenspeftpylet

SCOPe Domain Coordinates for d2b7dt1:

Click to download the PDB-style file with coordinates for d2b7dt1.
(The format of our PDB-style files is described here.)

Timeline for d2b7dt1: