Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily) 2 intertwined domains; all-beta and alpha+beta |
Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) |
Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (3 proteins) |
Protein Envelope glycoprotein [56985] (2 species) |
Species Dengue virus type 2 [TaxId:11060] [90131] (8 PDB entries) Uniprot P12823 281-675 |
Domain d2b6ba2: 2b6b A:1-297 [127977] Other proteins in same PDB: d2b6ba1, d2b6bb1, d2b6bc1, d2b6bd1 automatically matched to d1tg8a2 |
PDB Entry: 2b6b (more details), 25 Å
SCOPe Domain Sequences for d2b6ba2:
Sequence, based on SEQRES records: (download)
>d2b6ba2 f.10.1.1 (A:1-297) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]} mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc ieakltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamft ckknmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygt vtmecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm
>d2b6ba2 f.10.1.1 (A:1-297) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]} mrcigisnrdfvegvsswvdivlehgscvttmaknkptldfelikteakqpatlrkycie akltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamftck knmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygtvt mecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgagsnwiqketlvtfknpha kkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm
Timeline for d2b6ba2: