Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily) core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243 |
Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) |
Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins) |
Protein Hypothetical oxidoreductase SP0622 [143608] (1 species) |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [143609] (1 PDB entry) Uniprot Q97S03 1-201 |
Domain d2b67b_: 2b67 B: [127971] automated match to d2b67a1 complexed with acy, fmn |
PDB Entry: 2b67 (more details), 2.05 Å
SCOPe Domain Sequences for d2b67b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b67b_ d.90.1.1 (B:) Hypothetical oxidoreductase SP0622 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} kflelnkkrhatkhftdklvdpkdvrtaieiatlapsahnsqpwkfvvvreknaelakla ygsnfeqvssapvtialftdtdlakrarkiarvggannfseeqlqyfmknlpaefaryse qqvsdylalnaglvamnlvlaltdqgigsniilgfdkskvnevleiedrfrpellitvgy tdeklepsyrlpvdeiiekr
Timeline for d2b67b_: