Lineage for d2b67a1 (2b67 A:1-201)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963273Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2963274Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2963275Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins)
  6. 2963294Protein Hypothetical oxidoreductase SP0622 [143608] (1 species)
  7. 2963295Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [143609] (1 PDB entry)
    Uniprot Q97S03 1-201
  8. 2963296Domain d2b67a1: 2b67 A:1-201 [127970]
    complexed with acy, fmn

Details for d2b67a1

PDB Entry: 2b67 (more details), 2.05 Å

PDB Description: crystal structure of the nitroreductase family protein from streptococcus pneumoniae tigr4
PDB Compounds: (A:) COG0778: Nitroreductase

SCOPe Domain Sequences for d2b67a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b67a1 d.90.1.1 (A:1-201) Hypothetical oxidoreductase SP0622 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mkflelnkkrhatkhftdklvdpkdvrtaieiatlapsahnsqpwkfvvvreknaelakl
aygsnfeqvssapvtialftdtdlakrarkiarvggannfseeqlqyfmknlpaefarys
eqqvsdylalnaglvamnlvlaltdqgigsniilgfdkskvnevleiedrfrpellitvg
ytdeklepsyrlpvdeiiekr

SCOPe Domain Coordinates for d2b67a1:

Click to download the PDB-style file with coordinates for d2b67a1.
(The format of our PDB-style files is described here.)

Timeline for d2b67a1: