Lineage for d2b5ud1 (2b5u D:1-84)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 857507Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 857692Superfamily d.26.2: Colicin E3 immunity protein [54552] (1 family) (S)
  5. 857693Family d.26.2.1: Colicin E3 immunity protein [54553] (1 protein)
  6. 857694Protein Colicin E3 immunity protein [54554] (1 species)
  7. 857695Species Escherichia coli [TaxId:562] [54555] (4 PDB entries)
  8. 857700Domain d2b5ud1: 2b5u D:1-84 [127913]
    Other proteins in same PDB: d2b5ua1, d2b5ua2, d2b5ua3, d2b5uc1, d2b5uc2, d2b5uc3
    automatically matched to d1e44a_
    complexed with cit; mutant

Details for d2b5ud1

PDB Entry: 2b5u (more details), 2.3 Å

PDB Description: crystal structure of colicin e3 v206c mutant in complex with its immunity protein
PDB Compounds: (D:) Colicin E3 immunity protein

SCOP Domain Sequences for d2b5ud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b5ud1 d.26.2.1 (D:1-84) Colicin E3 immunity protein {Escherichia coli [TaxId: 562]}
glkldltwfdkstedfkgeeyskdfgddgsvmeslgvpfkdnvnngcfdviaewvpllqp
yfnhqidisdneyfvsfdyrdgdw

SCOP Domain Coordinates for d2b5ud1:

Click to download the PDB-style file with coordinates for d2b5ud1.
(The format of our PDB-style files is described here.)

Timeline for d2b5ud1: