Lineage for d2b5uc3 (2b5u C:316-454)

  1. Root: SCOP 1.75
  2. 894739Class h: Coiled coil proteins [57942] (7 folds)
  3. 896123Fold h.4: Antiparallel coiled-coil [58086] (17 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 896197Superfamily h.4.9: Colicin E3 receptor domain [69985] (1 family) (S)
  5. 896198Family h.4.9.1: Colicin E3 receptor domain [69986] (1 protein)
  6. 896199Protein Colicin E3 receptor domain [69987] (1 species)
  7. 896200Species Escherichia coli [TaxId:562] [69988] (4 PDB entries)
  8. 896202Domain d2b5uc3: 2b5u C:316-454 [127912]
    Other proteins in same PDB: d2b5ua1, d2b5ua2, d2b5ub1, d2b5uc1, d2b5uc2, d2b5ud1
    automatically matched to d1jcha3
    complexed with cit; mutant

Details for d2b5uc3

PDB Entry: 2b5u (more details), 2.3 Å

PDB Description: crystal structure of colicin e3 v206c mutant in complex with its immunity protein
PDB Compounds: (C:) Colicin E3

SCOP Domain Sequences for d2b5uc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b5uc3 h.4.9.1 (C:316-454) Colicin E3 receptor domain {Escherichia coli [TaxId: 562]}
veaaernyeraraelnqanedvarnqerqakavqvynsrkseldaanktladaiaeikqf
nrfahdpmagghrmwqmaglkaqraqtdvnnkqaafdaaakeksdadaalssamesrkkk
edkkrsaennlndeknkpr

SCOP Domain Coordinates for d2b5uc3:

Click to download the PDB-style file with coordinates for d2b5uc3.
(The format of our PDB-style files is described here.)

Timeline for d2b5uc3: