Lineage for d2b4sb_ (2b4s B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1930676Protein Insulin receptor [56162] (1 species)
    PTK group; InsR subfamily; membrane spanning protein tyrosine kinase
  7. 1930677Species Human (Homo sapiens) [TaxId:9606] [56163] (16 PDB entries)
  8. 1930688Domain d2b4sb_: 2b4s B: [127854]
    Other proteins in same PDB: d2b4sa_, d2b4sc_
    automated match to d1p14a_
    complexed with so4

Details for d2b4sb_

PDB Entry: 2b4s (more details), 2.3 Å

PDB Description: crystal structure of a complex between ptp1b and the insulin receptor tyrosine kinase
PDB Compounds: (B:) Insulin receptor

SCOPe Domain Sequences for d2b4sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b4sb_ d.144.1.7 (B:) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}
dewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslreriefln
easvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpgrppptl
qemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyetdyyrkg
gkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkfvmdgg
yldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsffhseenk

SCOPe Domain Coordinates for d2b4sb_:

Click to download the PDB-style file with coordinates for d2b4sb_.
(The format of our PDB-style files is described here.)

Timeline for d2b4sb_: