![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.13: PepX C-terminal domain-like [69222] (3 proteins) |
![]() | Protein Alpha-amino acid ester hydrolase [89247] (2 species) |
![]() | Species Acetobacter pasteurianus [TaxId:438] [101591] (4 PDB entries) |
![]() | Domain d2b4kd1: 2b4k D:435-666 [127843] Other proteins in same PDB: d2b4ka2, d2b4kb2, d2b4kc2, d2b4kd2 automatically matched to d1nx9a1 complexed with gol, pg9 |
PDB Entry: 2b4k (more details), 3.3 Å
SCOPe Domain Sequences for d2b4kd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b4kd1 b.18.1.13 (D:435-666) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} psvcesnctggltplyladghglsfthpaadgadsyvsdpahpvpfisrpfafaqssrwk pwlvqdqreaesrpdvvtyetevldepvrvsgvpvadlfaatsgtdsdwvvklidvqpam tpddpkmggyelpvsmdifrgryrkdfakpealqpdatlhyhftlpavnhvfakghrimv qiqsswfplydrnpqkfvpnifdakpadytvatqsihhggkeatsillpvvk
Timeline for d2b4kd1: