Lineage for d2b4gc_ (2b4g C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1567263Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 1567744Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 1567745Protein automated matches [190048] (17 species)
    not a true protein
  7. 1567869Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [186962] (1 PDB entry)
  8. 1567871Domain d2b4gc_: 2b4g C: [127831]
    Other proteins in same PDB: d2b4ga1
    automated match to d1dora_
    complexed with br, fmn, gol, oro

Details for d2b4gc_

PDB Entry: 2b4g (more details), 1.95 Å

PDB Description: dihydroorotate dehydrogenase
PDB Compounds: (C:) dihydroorotate dehydrogenase

SCOPe Domain Sequences for d2b4gc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b4gc_ c.1.4.0 (C:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mslkvnilghefsnpfmnaagvlctteedlrrmtesesgsligksctlaprtgnpepryf
glplgsinsmglpnlgvdfylsyaaqthdysrkplflsmsglsveesvemvkklvpitke
kgtilelnlscpnvpgkpqvgydfdttrtylqkvseayglpfgvkmppyfdiahfdmaaa
vlndfplvkfitcvnsignglvidpanetvvikpkqgfgglggkyvlptalanvnaffrr
cpdklvfgcggvysgeeaflhilagasmvqvgtalhdegpiifarlnkelqeimtnkgyk
tldefrgrvktmd

SCOPe Domain Coordinates for d2b4gc_:

Click to download the PDB-style file with coordinates for d2b4gc_.
(The format of our PDB-style files is described here.)

Timeline for d2b4gc_: