Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.0: automated matches [191310] (1 protein) not a true family |
Protein automated matches [190048] (17 species) not a true protein |
Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [186962] (1 PDB entry) |
Domain d2b4gc_: 2b4g C: [127831] Other proteins in same PDB: d2b4ga1 automated match to d1dora_ complexed with br, fmn, gol, oro |
PDB Entry: 2b4g (more details), 1.95 Å
SCOPe Domain Sequences for d2b4gc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b4gc_ c.1.4.0 (C:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} mslkvnilghefsnpfmnaagvlctteedlrrmtesesgsligksctlaprtgnpepryf glplgsinsmglpnlgvdfylsyaaqthdysrkplflsmsglsveesvemvkklvpitke kgtilelnlscpnvpgkpqvgydfdttrtylqkvseayglpfgvkmppyfdiahfdmaaa vlndfplvkfitcvnsignglvidpanetvvikpkqgfgglggkyvlptalanvnaffrr cpdklvfgcggvysgeeaflhilagasmvqvgtalhdegpiifarlnkelqeimtnkgyk tldefrgrvktmd
Timeline for d2b4gc_: