![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.3: C2 set domains [49142] (8 proteins) |
![]() | Protein CD4 C2-set domains [49149] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49150] (32 PDB entries) |
![]() | Domain d2b4cc2: 2b4c C:98-175 [127821] Other proteins in same PDB: d2b4cc1, d2b4cg1, d2b4ch1, d2b4ch2, d2b4cl1, d2b4cl2 automatically matched to d1g9mc2 complexed with nag, so4, xyl |
PDB Entry: 2b4c (more details), 3.3 Å
SCOPe Domain Sequences for d2b4cc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b4cc2 b.1.1.3 (C:98-175) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw tctvlqnqkkvefkidiv
Timeline for d2b4cc2: