SCOPe 2.08: Domain d2b4cc2: 2b4c C:98-175

Lineage for d2b4cc2 (2b4c C:98-175)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.3: C2 set domains [49142] (8 proteins)

6. Protein CD4 C2-set domains [49149] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49150] (32 PDB entries)

8. Domain d2b4cc2: 2b4c C:98-175 [127821]
   Other proteins in same PDB: d2b4cc1, d2b4cg1, d2b4ch1, d2b4ch2, d2b4cl1, d2b4cl2
   automatically matched to d1g9mc2
   complexed with nag, so4, xyl

Details for d2b4cc2

PDB Entry: 2b4c, 3.3 Å

PDB Description: crystal structure of hiv-1 jr-fl gp120 core protein containing the third variable region (v3) complexed with cd4 and the x5 antibody

PDB Compounds: (C:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d2b4cc2:

Sequence; same for both SEQRES and ATOM records:

>d2b4cc2 b.1.1.3 (C:98-175) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidiv

Timeline for d2b4cc2:

• d2b4cc2 first appeared in SCOP 1.73
  
• d2b4cc2 appears in SCOPe 2.07