![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
![]() | Superfamily c.97.1: Cytidine deaminase-like [53927] (4 families) ![]() contains extra C-terminal strand 5, order 21345 |
![]() | Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (7 proteins) strand 5 is parallel to strand 4 |
![]() | Protein Riboflavin biosynthesis protein RibD [142837] (2 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [142838] (2 PDB entries) |
![]() | Domain d2b3zc2: 2b3z C:1-145 [127812] Other proteins in same PDB: d2b3za1, d2b3zb1, d2b3zc1, d2b3zd1 automatically matched to 2B3Z A:1-145 complexed with zn |
PDB Entry: 2b3z (more details), 2.41 Å
SCOP Domain Sequences for d2b3zc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b3zc2 c.97.1.2 (C:1-145) Riboflavin biosynthesis protein RibD {Bacillus subtilis [TaxId: 1423]} meeyymklaldlakqgegqtesnplvgavvvkdgqivgmgahlkygeahaevhaihmaga haegadiyvtlepcshygktppcaeliinsgikrvfvamrdpnplvagrgismmkeagie vregiladqaerlnekflhfmrtgl
Timeline for d2b3zc2: