Lineage for d2b3zd2 (2b3z D:1-145)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 711877Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 711878Superfamily c.97.1: Cytidine deaminase-like [53927] (4 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 711934Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (7 proteins)
    strand 5 is parallel to strand 4
  6. 711965Protein Riboflavin biosynthesis protein RibD [142837] (2 species)
  7. 711966Species Bacillus subtilis [TaxId:1423] [142838] (2 PDB entries)
  8. 711970Domain d2b3zd2: 2b3z D:1-145 [127814]
    Other proteins in same PDB: d2b3za1, d2b3zb1, d2b3zc1, d2b3zd1
    automatically matched to 2B3Z A:1-145
    complexed with zn

Details for d2b3zd2

PDB Entry: 2b3z (more details), 2.41 Å

PDB Description: crystal structure of a bifunctional deaminase and reductase involved in riboflavin biosynthesis
PDB Compounds: (D:) Riboflavin biosynthesis protein ribD

SCOP Domain Sequences for d2b3zd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b3zd2 c.97.1.2 (D:1-145) Riboflavin biosynthesis protein RibD {Bacillus subtilis [TaxId: 1423]}
meeyymklaldlakqgegqtesnplvgavvvkdgqivgmgahlkygeahaevhaihmaga
haegadiyvtlepcshygktppcaeliinsgikrvfvamrdpnplvagrgismmkeagie
vregiladqaerlnekflhfmrtgl

SCOP Domain Coordinates for d2b3zd2:

Click to download the PDB-style file with coordinates for d2b3zd2.
(The format of our PDB-style files is described here.)

Timeline for d2b3zd2: