![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.83: Aconitase iron-sulfur domain [53731] (1 superfamily) consists of three similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.83.1: Aconitase iron-sulfur domain [53732] (1 family) ![]() |
![]() | Family c.83.1.1: Aconitase iron-sulfur domain [53733] (4 proteins) duplication: consists of three structurally similar subdomains with subdomains 1 and 3 being related by pseudo twofold symmetry |
![]() | Protein Iron-responsive element binding protein 1, N-terminal domain [142758] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142759] (2 PDB entries) Uniprot P21399 2-630 |
![]() | Domain d2b3yb2: 2b3y B:2-630 [127806] Other proteins in same PDB: d2b3ya1, d2b3yb1 automated match to d2b3xa2 complexed with act, fmt, gol, sf4 |
PDB Entry: 2b3y (more details), 1.85 Å
SCOPe Domain Sequences for d2b3yb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b3yb2 c.83.1.1 (B:2-630) Iron-responsive element binding protein 1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} snpfahlaepldpvqpgkkffnlnkledsrygrlpfsirvlleaairncdeflvkkqdie nilhwnvtqhknievpfkparvilqdftgvpavvdfaamrdavkklggdpekinpvcpad lvidhsiqvdfnrradslqknqdlefernrerfeflkwgsqafhnmriippgsgiihqvn leylarvvfdqdgyyypdslvgtdshttmidglgilgwgvggieaeavmlgqpismvlpq vigyrlmgkphplvtstdivltitkhlrqvgvvgkfveffgpgvaqlsiadratianmcp eygataaffpvdevsitylvqtgrdeeklkyikkylqavgmfrdfndpsqdpdftqvvel dlktvvpccsgpkrpqdkvavsdmkkdfesclgakqgfkgfqvapehhndhktfiydnte ftlahgsvviaaitsctntsnpsvmlgagllakkavdaglnvmpyiktslspgsgvvtyy lqesgvmpylsqlgfdvvgygcmtcignsgplpepvveaitqgdlvavgvlsgnrnfegr vhpntranylaspplviayaiagtiridfekeplgvnakgqqvflkdiwptrdeiqaver qyvipgmfkevyqkietvneswnalatps
Timeline for d2b3yb2: