Lineage for d2b3yb2 (2b3y B:2-630)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2141742Fold c.83: Aconitase iron-sulfur domain [53731] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2141743Superfamily c.83.1: Aconitase iron-sulfur domain [53732] (1 family) (S)
  5. 2141744Family c.83.1.1: Aconitase iron-sulfur domain [53733] (4 protein domains)
    duplication: consists of three structurally similar subdomains with subdomains 1 and 3 being related by pseudo twofold symmetry
  6. 2141767Protein Iron-responsive element binding protein 1, N-terminal domain [142758] (1 species)
  7. 2141768Species Human (Homo sapiens) [TaxId:9606] [142759] (2 PDB entries)
    Uniprot P21399 2-630
  8. 2141770Domain d2b3yb2: 2b3y B:2-630 [127806]
    Other proteins in same PDB: d2b3ya1, d2b3yb1
    automated match to d2b3xa2
    complexed with act, fmt, gol, sf4

Details for d2b3yb2

PDB Entry: 2b3y (more details), 1.85 Å

PDB Description: Structure of a monoclinic crystal form of human cytosolic aconitase (IRP1)
PDB Compounds: (B:) Iron-responsive element binding protein 1

SCOPe Domain Sequences for d2b3yb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b3yb2 c.83.1.1 (B:2-630) Iron-responsive element binding protein 1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
snpfahlaepldpvqpgkkffnlnkledsrygrlpfsirvlleaairncdeflvkkqdie
nilhwnvtqhknievpfkparvilqdftgvpavvdfaamrdavkklggdpekinpvcpad
lvidhsiqvdfnrradslqknqdlefernrerfeflkwgsqafhnmriippgsgiihqvn
leylarvvfdqdgyyypdslvgtdshttmidglgilgwgvggieaeavmlgqpismvlpq
vigyrlmgkphplvtstdivltitkhlrqvgvvgkfveffgpgvaqlsiadratianmcp
eygataaffpvdevsitylvqtgrdeeklkyikkylqavgmfrdfndpsqdpdftqvvel
dlktvvpccsgpkrpqdkvavsdmkkdfesclgakqgfkgfqvapehhndhktfiydnte
ftlahgsvviaaitsctntsnpsvmlgagllakkavdaglnvmpyiktslspgsgvvtyy
lqesgvmpylsqlgfdvvgygcmtcignsgplpepvveaitqgdlvavgvlsgnrnfegr
vhpntranylaspplviayaiagtiridfekeplgvnakgqqvflkdiwptrdeiqaver
qyvipgmfkevyqkietvneswnalatps

SCOPe Domain Coordinates for d2b3yb2:

Click to download the PDB-style file with coordinates for d2b3yb2.
(The format of our PDB-style files is described here.)

Timeline for d2b3yb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2b3yb1