Lineage for d2b37a_ (2b37 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1576689Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1577205Protein Enoyl-ACP reductase [51791] (11 species)
  7. 1577319Species Mycobacterium tuberculosis, TB, gene InhA [TaxId:1773] [51793] (50 PDB entries)
  8. 1577394Domain d2b37a_: 2b37 A: [127779]
    automated match to d1bvra_
    complexed with 8ps, nad

Details for d2b37a_

PDB Entry: 2b37 (more details), 2.6 Å

PDB Description: Crystal structure of Mycobacterium tuberculosis enoyl reductase (InhA) inhibited by 5-octyl-2-phenoxyphenol
PDB Compounds: (A:) Enoyl-[acyl-carrier-protein] reductase [NADH]

SCOPe Domain Sequences for d2b37a_:

Sequence, based on SEQRES records: (download)

>d2b37a_ c.2.1.2 (A:) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]}
tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih
isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
ygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvakt
vcallsdwlpattgdiiyadggahtqll

Sequence, based on observed residues (ATOM records): (download)

>d2b37a_ c.2.1.2 (A:) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]}
tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih
isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
ygvrsnlvaagpirtlleegwdqrapigwnmkdatpvaktvcallsdwlpattgdiiyad
ggahtqll

SCOPe Domain Coordinates for d2b37a_:

Click to download the PDB-style file with coordinates for d2b37a_.
(The format of our PDB-style files is described here.)

Timeline for d2b37a_: