Lineage for d2b2qa2 (2b2q A:441-748)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1093055Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1093056Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 1093469Family a.93.1.3: Catalase-peroxidase KatG [74753] (1 protein)
    duplication: tandem repeat of two CCP-like domains
  6. 1093470Protein Catalase-peroxidase KatG [74754] (4 species)
    only the N-terminal CCP-like domain binds heme
  7. 1093471Species Burkholderia pseudomallei [TaxId:28450] [89093] (14 PDB entries)
    Uniprot P13029 Q939D2 35-748
  8. 1093501Domain d2b2qa2: 2b2q A:441-748 [127717]
    automatically matched to d1mwva2
    complexed with hem, na, peo, trs

Details for d2b2qa2

PDB Entry: 2b2q (more details), 2.05 Å

PDB Description: crystal structure of native catalase-peroxidase katg at ph7.5
PDB Compounds: (A:) Catalase-peroxidase

SCOPe Domain Sequences for d2b2qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b2qa2 a.93.1.3 (A:441-748) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]}
aevllwqdpipavdhplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrgga
ngarirlapqkdweanqpeqlaavletleairtafngaqrggkqvsladlivlagcagve
qaaknaghavtvpfapgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdk
aqlltlsapemtvllgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaa
dadvfegrdratgelkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvm
nldrfdla

SCOPe Domain Coordinates for d2b2qa2:

Click to download the PDB-style file with coordinates for d2b2qa2.
(The format of our PDB-style files is described here.)

Timeline for d2b2qa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2b2qa1