Lineage for d2b0va1 (2b0v A:4-149)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971309Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2971567Protein Hypothetical protein NE0184 [143760] (1 species)
  7. 2971568Species Nitrosomonas europaea [TaxId:915] [143761] (1 PDB entry)
    Uniprot Q82XR9 4-149
  8. 2971569Domain d2b0va1: 2b0v A:4-149 [127650]
    Other proteins in same PDB: d2b0va2
    complexed with cl, edo, na

Details for d2b0va1

PDB Entry: 2b0v (more details), 1.55 Å

PDB Description: nudix hydrolase from nitrosomonas europaea.
PDB Compounds: (A:) NUDIX hydrolase

SCOPe Domain Sequences for d2b0va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]}
kpnvtvaavieqddkyllveeiprgtaiklnqpaghlepgesiiqacsrevleetghsfl
pevltgiyhwtcasngttylrftfsgqvvsfdpdrkldtgivraawfsideirakqamhr
tplvmqciedyhagkrypldilqyyd

SCOPe Domain Coordinates for d2b0va1:

Click to download the PDB-style file with coordinates for d2b0va1.
(The format of our PDB-style files is described here.)

Timeline for d2b0va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2b0va2