Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (31 species) not a true protein |
Species Alcaligenes faecalis [TaxId:511] [226762] (16 PDB entries) |
Domain d2b08b2: 2b08 B:162-339 [127629] automated match to d3h4fa2 complexed with acm, cu1 |
PDB Entry: 2b08 (more details), 1.9 Å
SCOPe Domain Sequences for d2b08b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b08b2 b.6.1.0 (B:162-339) automated matches {Alcaligenes faecalis [TaxId: 511]} lhdgkgkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfn gavgaltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetw fipggaagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsg
Timeline for d2b08b2:
View in 3D Domains from other chains: (mouse over for more information) d2b08a1, d2b08a2, d2b08c1, d2b08c2 |