Lineage for d2b08a1 (2b08 A:5-161)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2366402Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2366403Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2367979Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2367980Protein automated matches [190824] (23 species)
    not a true protein
  7. 2367999Species Alcaligenes faecalis [TaxId:511] [226762] (16 PDB entries)
  8. 2368038Domain d2b08a1: 2b08 A:5-161 [127626]
    automated match to d3h4fa1
    complexed with acm, cu1

Details for d2b08a1

PDB Entry: 2b08 (more details), 1.9 Å

PDB Description: Reduced acetamide-bound M150G Nitrite Reductase from Alcaligenes faecalis
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d2b08a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b08a1 b.6.1.0 (A:5-161) automated matches {Alcaligenes faecalis [TaxId: 511]}
taaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamaf
ngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilrf
katkpgvfvyhcappgmvpwhvvsggngaimvlpreg

SCOPe Domain Coordinates for d2b08a1:

Click to download the PDB-style file with coordinates for d2b08a1.
(The format of our PDB-style files is described here.)

Timeline for d2b08a1: