Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (7 families) |
Family d.113.1.1: MutT-like [55812] (16 proteins) |
Protein Hypothetical protein SP1235 (spr1115) [143762] (1 species) |
Species Streptococcus pneumoniae [TaxId:1313] [143763] (1 PDB entry) Uniprot Q97QH6 1-155 |
Domain d2b06a1: 2b06 A:1-155 [127624] complexed with mg |
PDB Entry: 2b06 (more details), 1.4 Å
SCOP Domain Sequences for d2b06a1:
Sequence, based on SEQRES records: (download)
>d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} msrsqltiltnicliedletqrvvmqyrapennrwsgyafpgghvendeafaesvireiy eetgltiqnpqlvgiknwpldtggryivicykatefsgtlqsseegevswvqkdqipnln laydmlplmemmeapdkseffyprrteddwekkif
>d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} msrsqltiltnicliedletqrvvmqyrawsgyafpgghvendeafaesvireiyeetgl tiqnpqlvgiknwpldtggryivicykatefsgtlqsseegevswvqkdqipnlnlaydm lplmemmeapdkseffyprrteddwekkif
Timeline for d2b06a1: