Lineage for d2b06a1 (2b06 A:1-155)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971309Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2971580Protein Hypothetical protein SP1235 (spr1115) [143762] (1 species)
  7. 2971581Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [143763] (1 PDB entry)
    Uniprot Q97QH6 1-155
  8. 2971582Domain d2b06a1: 2b06 A:1-155 [127624]
    complexed with mg

Details for d2b06a1

PDB Entry: 2b06 (more details), 1.4 Å

PDB Description: Crystal structure of the MutT/nudix family protein from Streptococcus pneumoniae
PDB Compounds: (A:) MutT/nudix family protein

SCOPe Domain Sequences for d2b06a1:

Sequence, based on SEQRES records: (download)

>d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
msrsqltiltnicliedletqrvvmqyrapennrwsgyafpgghvendeafaesvireiy
eetgltiqnpqlvgiknwpldtggryivicykatefsgtlqsseegevswvqkdqipnln
laydmlplmemmeapdkseffyprrteddwekkif

Sequence, based on observed residues (ATOM records): (download)

>d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
msrsqltiltnicliedletqrvvmqyrawsgyafpgghvendeafaesvireiyeetgl
tiqnpqlvgiknwpldtggryivicykatefsgtlqsseegevswvqkdqipnlnlaydm
lplmemmeapdkseffyprrteddwekkif

SCOPe Domain Coordinates for d2b06a1:

Click to download the PDB-style file with coordinates for d2b06a1.
(The format of our PDB-style files is described here.)

Timeline for d2b06a1: