Lineage for d2az3g_ (2az3 G:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2194362Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2194363Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2194364Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2194403Species Halobacterium salinarum [TaxId:2242] [143288] (2 PDB entries)
    Uniprot P61136 4-158
  8. 2194410Domain d2az3g_: 2az3 G: [127594]
    automated match to d1ndla_
    complexed with cdp, mg

Details for d2az3g_

PDB Entry: 2az3 (more details), 2.2 Å

PDB Description: structure of a halophilic nucleoside diphosphate kinase from halobacterium salinarum in complex with cdp
PDB Compounds: (G:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d2az3g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2az3g_ d.58.6.1 (G:) Nucleoside diphosphate kinase, NDK {Halobacterium salinarum [TaxId: 2242]}
hdertfvmvkpdgvqrgligdivtrletkglkmvggkfmrideelahehyaehedkpffd
glvsfitsgpvfamvwegadatrqvrqlmgatdaqdaapgtirgdygndlghnlihgsdh
edeganereialffdddelvdwdrdasawvye

SCOPe Domain Coordinates for d2az3g_:

Click to download the PDB-style file with coordinates for d2az3g_.
(The format of our PDB-style files is described here.)

Timeline for d2az3g_: