Lineage for d2ayya1 (2ayy A:700-816)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 691581Superfamily c.23.1: CheY-like [52172] (7 families) (S)
  5. 691857Family c.23.1.6: RcsC linker domain-like [142037] (1 protein)
    PfamB 016190; probable rudiment CheY-like domain; precedes the C-terminal CheY-related domain of similar structure
  6. 691858Protein Sensor kinase protein RcsC [142038] (1 species)
  7. 691859Species Escherichia coli [TaxId:562] [142039] (2 PDB entries)
  8. 691860Domain d2ayya1: 2ayy A:700-816 [127576]
    linker domain only

Details for d2ayya1

PDB Entry: 2ayy (more details)

PDB Description: solution structure of the e.coli rcsc c-terminus (residues 700-816) containing linker region
PDB Compounds: (A:) Sensor kinase protein rcsC

SCOP Domain Sequences for d2ayya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ayya1 c.23.1.6 (A:700-816) Sensor kinase protein RcsC {Escherichia coli [TaxId: 562]}
gveglsgkrcwlavrnaslcqfletslqrsgivvttyegqeptpedvlitdevvskkwqg
ravvtfcrrhigiplekapgewvhsvaaphelpallariyliemesddpanalpstd

SCOP Domain Coordinates for d2ayya1:

Click to download the PDB-style file with coordinates for d2ayya1.
(The format of our PDB-style files is described here.)

Timeline for d2ayya1: