| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
| Family c.23.1.6: RcsC linker domain-like [142037] (1 protein) PfamB PB016190; probable rudiment CheY-like domain; precedes the C-terminal CheY-related domain of similar structure automatically mapped to Pfam PF09456 |
| Protein Sensor kinase protein RcsC [142038] (1 species) |
| Species Escherichia coli [TaxId:562] [142039] (2 PDB entries) Uniprot P14376 700-816 |
| Domain d2ayya1: 2ayy A:700-816 [127576] Other proteins in same PDB: d2ayya2 linker domain only |
PDB Entry: 2ayy (more details)
SCOPe Domain Sequences for d2ayya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ayya1 c.23.1.6 (A:700-816) Sensor kinase protein RcsC {Escherichia coli [TaxId: 562]}
gveglsgkrcwlavrnaslcqfletslqrsgivvttyegqeptpedvlitdevvskkwqg
ravvtfcrrhigiplekapgewvhsvaaphelpallariyliemesddpanalpstd
Timeline for d2ayya1: