SCOPe 2.02: Domain d2axzc2: 2axz C:73-284

Lineage for d2axzc2 (2axz C:73-284)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (9 families)

5. Family a.118.8.4: PrgX C-terminal domain-like [140848] (1 protein)

6. Protein PrgX [140849] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [140850] (7 PDB entries)
   Uniprot Q04114 70-287! Uniprot Q04114 71-301

8. Domain d2axzc2: 2axz C:73-284 [127541]
   Other proteins in same PDB: d2axza1, d2axzb1, d2axzc1, d2axzd1
   automatically matched to 2AW6 A:70-287
   protein/DNA complex

Details for d2axzc2

PDB Entry: 2axz, 3 Å

PDB Description: Crystal structure of PrgX/cCF10 complex

PDB Compounds: (C:) PrgX

SCOPe Domain Sequences for d2axzc2:

Sequence; same for both SEQRES and ATOM records:

>d2axzc2 a.118.8.4 (C:73-284) PrgX {Enterococcus faecalis [TaxId: 1351]}
netgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynievptfnk
titsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgkdydltiqt
vlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqfltdknid
sylnavniinifkiigkedihrslveeltkis

Timeline for d2axzc2:

• d2axzc2 first appeared in SCOP 1.73
  
• d2axzc2 appears in SCOPe 2.01
  
• d2axzc2 appears in SCOPe 2.03
  
• d2axzc2 appears in the current release, SCOPe 2.08