| Class b: All beta proteins [48724] (178 folds) |
| Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.6: MOP-like [50331] (4 families) ![]() |
| Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins) probably stems out from the biMOP domain |
| Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species) |
| Species Escherichia coli [TaxId:562] [101772] (15 PDB entries) |
| Domain d2awob1: 2awo B:236-371 [127469] Other proteins in same PDB: d2awoa2, d2awoa3, d2awob2, d2awob3, d2awoc2, d2awoc3, d2awod2, d2awod3 automated match to d1q12a1 complexed with adp, mg |
PDB Entry: 2awo (more details), 2.8 Å
SCOPe Domain Sequences for d2awob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2awob1 b.40.6.3 (B:236-371) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]}
spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi
advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf
redgtacrrlhkepgv
Timeline for d2awob1: