SCOPe 2.05: Domain d2awnb1: 2awn B:236-375

Lineage for d2awnb1 (2awn B:236-375)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.6: MOP-like [50331] (4 families)

5. Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins)
   probably stems out from the biMOP domain

6. Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species)

7. Species Escherichia coli [TaxId:562] [101772] (15 PDB entries)

8. Domain d2awnb1: 2awn B:236-375 [127461]
   Other proteins in same PDB: d2awna2, d2awnb2, d2awnc2, d2awnd2
   automated match to d1q12a1
   complexed with adp, mg

Details for d2awnb1

PDB Entry: 2awn, 2.3 Å

PDB Description: Crystal structure of the ADP-Mg-bound E. Coli MALK (Crystallized with ATP-Mg)

PDB Compounds: (B:) Maltose/maltodextrin import ATP-binding protein malK

SCOPe Domain Sequences for d2awnb1:

Sequence; same for both SEQRES and ATOM records:

>d2awnb1 b.40.6.3 (B:236-375) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]}
spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi
advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf
redgtacrrlhkepgvasas

Timeline for d2awnb1:

• d2awnb1 first appeared in SCOP 1.73
  
• d2awnb1 appears in SCOPe 2.04
  
• d2awnb1 appears in SCOPe 2.06
  
• d2awnb1 appears in the current release, SCOPe 2.08