![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.40: OB-fold [50198] (12 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.6: MOP-like [50331] (3 families) ![]() |
![]() | Family b.40.6.3: ABC-transporter additional domain [50338] (3 proteins) probably stems out from the biMOP domain |
![]() | Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [101772] (5 PDB entries) |
![]() | Domain d2awnb1: 2awn B:236-370 [127461] Other proteins in same PDB: d2awna2, d2awnb2, d2awnc2, d2awnd2 automatically matched to d1q12a1 complexed with adp, mg |
PDB Entry: 2awn (more details), 2.3 Å
SCOP Domain Sequences for d2awnb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2awnb1 b.40.6.3 (B:236-370) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]} spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf redgtacrrlhkepg
Timeline for d2awnb1: