Lineage for d2awif1 (2awi F:3-66)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1087132Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1087133Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1087453Family a.35.1.11: PrgX N-terminal domain-like [140526] (1 protein)
    Part of Pfam PF01381
  6. 1087454Protein PrgX [140527] (1 species)
    possibly involved in pheromone-inducible conjugation
  7. 1087455Species Enterococcus faecalis [TaxId:1351] [140528] (7 PDB entries)
    Uniprot Q04114 1-69! Uniprot Q04114 2-66
  8. 1087461Domain d2awif1: 2awi F:3-66 [127445]
    Other proteins in same PDB: d2awia2, d2awib2, d2awic2, d2awid2, d2awie2, d2awif2, d2awig2, d2awih2, d2awii2, d2awij2, d2awik2, d2awil2
    automatically matched to 2AWI A:2-66
    mutant

Details for d2awif1

PDB Entry: 2awi (more details), 2.25 Å

PDB Description: structure of prgx y153c mutant
PDB Compounds: (F:) PrgX

SCOPe Domain Sequences for d2awif1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2awif1 a.35.1.11 (F:3-66) PrgX {Enterococcus faecalis [TaxId: 1351]}
kigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffeil
nrag

SCOPe Domain Coordinates for d2awif1:

Click to download the PDB-style file with coordinates for d2awif1.
(The format of our PDB-style files is described here.)

Timeline for d2awif1: