SCOPe 2.08: Domain d2avnb2: 2avn B:1-246

Lineage for d2avnb2 (2avn B:1-246)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.41: UbiE/COQ5-like [110671] (5 proteins)
   Pfam PF01209

6. Protein Hypothetical methyltransferase TM1389 [142595] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [142596] (1 PDB entry)
   Uniprot Q9X1A9 1-246

8. Domain d2avnb2: 2avn B:1-246 [127381]
   Other proteins in same PDB: d2avna2, d2avnb3
   automated match to d2avna1
   complexed with po4, sai

Details for d2avnb2

PDB Entry: 2avn, 2.35 Å

PDB Description: crystal structure of a ubiquinone/menaquinone biosynthesis methyltransferase-related protein (tm1389) from thermotoga maritima msb8 at 2.35 a resolution

PDB Compounds: (B:) ubiquinone/menaquinone biosynthesis methyltransferase-related protein

SCOPe Domain Sequences for d2avnb2:

Sequence; same for both SEQRES and ATOM records:

>d2avnb2 c.66.1.41 (B:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]}
mklrswefydriaraydsmyetpkwklyhrligsfleeylknpcrvldlgggtgkwslfl
qergfevvlvdpskemlevarekgvknvveakaedlpfpsgafeavlalgdvlsyvenkd
kafseirrvlvpdglliatvdnfytflqqmiekdawdqitrflktqttsvgttlfsfnsy
afkpedldslegfetvdirgigvmeypderisereetifrleqelsrdrniiwkadhiff
vlkkkr

Timeline for d2avnb2:

• d2avnb2 first appeared in SCOP 1.73, called d2avnb1
  
• d2avnb2 appears in SCOPe 2.07