SCOPe 2.02: Domain d2auwb2: 2auw B:4-87

Lineage for d2auwb2 (2auw B:4-87)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.331: NE0471 N-terminal domain-like [143879] (1 superfamily)
   beta(3)-alpha(n)-beta(3)-alpha; the two meander beta-sheets and helices are packed against the same core

4. Superfamily d.331.1: NE0471 N-terminal domain-like [143880] (1 family)

5. Family d.331.1.1: NE0471 N-terminal domain-like [143881] (1 protein)

6. Protein Hypothetical protein NE0471 N-terminal domain [143882] (1 species)

7. Species Nitrosomonas europaea [TaxId:915] [143883] (1 PDB entry)
   Uniprot Q82X29 4-87

8. Domain d2auwb2: 2auw B:4-87 [127342]
   Other proteins in same PDB: d2auwa1, d2auwb1
   automatically matched to 2AUW A:4-87
   complexed with fmt, gol

Details for d2auwb2

PDB Entry: 2auw, 1.85 Å

PDB Description: Crystal Structure of Putative DNA Binding Protein NE0471 from Nitrosomonas europaea ATCC 19718

PDB Compounds: (B:) hypothetical protein NE0471

SCOPe Domain Sequences for d2auwb2:

Sequence; same for both SEQRES and ATOM records:

>d2auwb2 d.331.1.1 (B:4-87) Hypothetical protein NE0471 N-terminal domain {Nitrosomonas europaea [TaxId: 915]}
yffpkltavealapyrlrttwstgevlevdvgdilrkipdlapildpeafarvhiaeweg
svewfdtefgrdnvyawakeqage

Timeline for d2auwb2:

• d2auwb2 first appeared in SCOP 1.73
  
• d2auwb2 appears in SCOPe 2.01
  
• d2auwb2 appears in SCOPe 2.03
  
• d2auwb2 appears in the current release, SCOPe 2.08