SCOPe 2.04: Domain d2auwa1: 2auw A:88-154

Lineage for d2auwa1 (2auw A:88-154)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.10: NE0471 C-terminal domain-like [140523] (1 protein)

6. Protein Hypothetical protein NE0471 C-terminal domain [140524] (1 species)

7. Species Nitrosomonas europaea [TaxId:915] [140525] (1 PDB entry)
   Uniprot Q82X29 88-154

8. Domain d2auwa1: 2auw A:88-154 [127339]
   Other proteins in same PDB: d2auwa2, d2auwb2
   complexed with fmt, gol

Details for d2auwa1

PDB Entry: 2auw, 1.85 Å

PDB Description: Crystal Structure of Putative DNA Binding Protein NE0471 from Nitrosomonas europaea ATCC 19718

PDB Compounds: (A:) hypothetical protein NE0471

SCOPe Domain Sequences for d2auwa1:

Sequence; same for both SEQRES and ATOM records:

>d2auwa1 a.35.1.10 (A:88-154) Hypothetical protein NE0471 C-terminal domain {Nitrosomonas europaea [TaxId: 915]}
vshemfgdwmhrnnlslttaaealgisrrmvsyyrtahkiiprtiwlaclgweatrpetk
tlprtlp

Timeline for d2auwa1:

• d2auwa1 first appeared in SCOP 1.73
  
• d2auwa1 appears in SCOPe 2.03
  
• d2auwa1 appears in SCOPe 2.05
  
• d2auwa1 appears in the current release, SCOPe 2.08