SCOP 1.73: Domain d2auna1: 2aun A:152-307

Lineage for d2auna1 (2aun A:152-307)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.10: LD-carboxypeptidase A C-terminal domain-like [141986] (1 family)

5. Family c.8.10.1: LD-carboxypeptidase A C-terminal domain-like [141987] (1 protein)
   C-terminal half of Pfam PF02016

6. Protein LD-carboxypeptidase A, C-terminal domain [141988] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [141989] (4 PDB entries)

8. Domain d2auna1: 2aun A:152-307 [127334]
   Other proteins in same PDB: d2auna2, d2aunb2
   mutant

Details for d2auna1

PDB Entry: 2aun, 2.4 Å

PDB Description: active site his285ala mutant of ld-carboxypeptidase

PDB Compounds: (A:) hypothetical protein

SCOP Domain Sequences for d2auna1:

Sequence; same for both SEQRES and ATOM records:

>d2auna1 c.8.10.1 (A:152-307) LD-carboxypeptidase A, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
qerlaslasvsrllagidhelpvqhlgghkqrvegaliggnltalacmagtlgglhapag
silvledvgepyyrlerslwqllesidarqlgaiclgsftdcprkevahslerifgeyaa
aievplyhhlpsgagaqnrawpygktavlegnrlrw

Timeline for d2auna1:

• d2auna1 is new in SCOP 1.73
  
• d2auna1 appears in SCOP 1.75
  
• d2auna1 appears in the current release, SCOPe 2.08