Lineage for d2auna2 (2aun A:5-142)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 692818Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (8 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 693098Family c.23.16.7: LD-carboxypeptidase A N-terminal domain-like [142074] (1 protein)
    N-terminal half of Pfam PF02016
  6. 693099Protein LD-carboxypeptidase A, N-terminal domain [142075] (1 species)
  7. 693100Species Pseudomonas aeruginosa [TaxId:287] [142076] (4 PDB entries)
  8. 693105Domain d2auna2: 2aun A:5-142 [127335]
    Other proteins in same PDB: d2auna1, d2aunb1
    mutant

Details for d2auna2

PDB Entry: 2aun (more details), 2.4 Å

PDB Description: active site his285ala mutant of ld-carboxypeptidase
PDB Compounds: (A:) hypothetical protein

SCOP Domain Sequences for d2auna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2auna2 c.23.16.7 (A:5-142) LD-carboxypeptidase A, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
pssdqtwqpidgrvaliapasaiatevleatlrqlevhgvdyhlgrhvearyrylagtve
qrledlhnafdmpditavwclrggygcgqllpgldwgrleaasprpligfsdisvllsaf
hrhglpaihgpvatglgl

SCOP Domain Coordinates for d2auna2:

Click to download the PDB-style file with coordinates for d2auna2.
(The format of our PDB-style files is described here.)

Timeline for d2auna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2auna1