Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein RhoQ [142261] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142262] (1 PDB entry) Uniprot P17081 1-185 |
Domain d2atxa1: 2atx A:9-193 [127315] complexed with gnp, mg |
PDB Entry: 2atx (more details), 2.65 Å
SCOP Domain Sequences for d2atxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} mahgpgalmlkcvvvgdgavgktcllmsyandafpeeyvptvfdhyavsvtvggkqyllg lydtagqedydrlrplsypmtdvflicfsvvnpasfqnvkeewvpelkeyapnvpfllig tqidlrddpktlarlndmkekpicveqgqklakeigaccyvecsaltqkglktvfdeaii ailtp
Timeline for d2atxa1: