Lineage for d2atxa1 (2atx A:9-193)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867868Protein RhoQ [142261] (1 species)
  7. 2867869Species Human (Homo sapiens) [TaxId:9606] [142262] (1 PDB entry)
    Uniprot P17081 1-185
  8. 2867870Domain d2atxa1: 2atx A:9-193 [127315]
    complexed with gnp, mg

Details for d2atxa1

PDB Entry: 2atx (more details), 2.65 Å

PDB Description: crystal structure of the tc10 gppnhp complex
PDB Compounds: (A:) small GTP binding protein TC10

SCOPe Domain Sequences for d2atxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]}
mahgpgalmlkcvvvgdgavgktcllmsyandafpeeyvptvfdhyavsvtvggkqyllg
lydtagqedydrlrplsypmtdvflicfsvvnpasfqnvkeewvpelkeyapnvpfllig
tqidlrddpktlarlndmkekpicveqgqklakeigaccyvecsaltqkglktvfdeaii
ailtp

SCOPe Domain Coordinates for d2atxa1:

Click to download the PDB-style file with coordinates for d2atxa1.
(The format of our PDB-style files is described here.)

Timeline for d2atxa1: