SCOP 1.73: Domain d2astb2: 2ast B:2136-2419

Lineage for d2astb2 (2ast B:2136-2419)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.1: RNI-like [52047] (3 families)
   regular structure consisting of similar repeats

5. Family c.10.1.3: Cyclin A/CDK2-associated p19, Skp2 [52055] (1 protein)
   this is a repeat family; one repeat unit is 1fqv C:251-227 found in domain

6. Protein Cyclin A/CDK2-associated p19, Skp2 [52056] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52057] (4 PDB entries)

8. Domain d2astb2: 2ast B:2136-2419 [127274]
   Other proteins in same PDB: d2astb1, d2astc1
   automatically matched to d1fqva2
   complexed with ben

Details for d2astb2

PDB Entry: 2ast, 2.3 Å

PDB Description: crystal structure of skp1-skp2-cks1 in complex with a p27 peptide

PDB Compounds: (B:) S-phase kinase-associated protein 2

SCOP Domain Sequences for d2astb2:

Sequence; same for both SEQRES and ATOM records:

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}
lwqtldltgknlhpdvtgrllsqgviafrcprsfmdqplaehfspfrvqhmdlsnsviev
stlhgilsqcsklqnlsleglrlsdpivntlaknsnlvrlnlsgcsgfsefalqtllssc
srldelnlswcfdftekhvqvavahvsetitqlnlsgyrknlqksdlstlvrrcpnlvhl
dlsdsvmlkndcfqeffqlnylqhlslsrcydiipetllelgeiptlktlqvfgivpdgt
lqllkealphlqincshfttiarptignkknqeiwgikcrltlq

Timeline for d2astb2:

• d2astb2 is new in SCOP 1.73
  
• d2astb2 appears in SCOP 1.75
  
• d2astb2 appears in the current release, SCOPe 2.08