Lineage for d2assb2 (2ass B:2136-2419)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1156062Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 1156063Superfamily c.10.1: RNI-like [52047] (3 families) (S)
    regular structure consisting of similar repeats
  5. 1156102Family c.10.1.3: Cyclin A/CDK2-associated p19, Skp2 [52055] (1 protein)
    this is a repeat family; one repeat unit is 1fqv C:251-227 found in domain
  6. 1156103Protein Cyclin A/CDK2-associated p19, Skp2 [52056] (1 species)
  7. 1156104Species Human (Homo sapiens) [TaxId:9606] [52057] (4 PDB entries)
  8. 1156106Domain d2assb2: 2ass B:2136-2419 [127271]
    Other proteins in same PDB: d2assb1, d2assc1
    automatically matched to d1fqva2
    complexed with ben, po4

Details for d2assb2

PDB Entry: 2ass (more details), 3 Å

PDB Description: crystal structure of the skp1-skp2-cks1 complex
PDB Compounds: (B:) S-phase kinase-associated protein 2

SCOPe Domain Sequences for d2assb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2assb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}
lwqtldltgknlhpdvtgrllsqgviafrcprsfmdqplaehfspfrvqhmdlsnsviev
stlhgilsqcsklqnlsleglrlsdpivntlaknsnlvrlnlsgcsgfsefalqtllssc
srldelnlswcfdftekhvqvavahvsetitqlnlsgyrknlqksdlstlvrrcpnlvhl
dlsdsvmlkndcfqeffqlnylqhlslsrcydiipetllelgeiptlktlqvfgivpdgt
lqllkealphlqincshfttiarptignkknqeiwgikcrltlq

SCOPe Domain Coordinates for d2assb2:

Click to download the PDB-style file with coordinates for d2assb2.
(The format of our PDB-style files is described here.)

Timeline for d2assb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2assb1
View in 3D
Domains from other chains:
(mouse over for more information)
d2assc1